PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g30080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family ZF-HD
Protein Properties Length: 99aa    MW: 10899.3 Da    PI: 9.552
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g30080genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.75.6e-333489258
  ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                 +++rY eC++NhAa++Gg+avDGC+Efm+s geegt+aal+CaACgCHRnFHRrev+
   CA03g30080 34 RNIRYVECQRNHAANIGGYAVDGCREFMAS-GEEGTTAALTCAACGCHRNFHRREVD 89
                 579**************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-143698IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.8E-313688IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.3E-273788IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.9953887IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009741Biological Processresponse to brassinosteroid
GO:0043392Biological Processnegative regulation of DNA binding
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048509Biological Processregulation of meristem development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 99 aa     Download sequence    Send to blast
LTRSLFRGFL VNPRMMKRRQ VVVRRNTSTT SSTRNIRYVE CQRNHAANIG GYAVDGCREF  60
MASGEEGTTA ALTCAACGCH RNFHRREVDG GEVVSESS*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016567575.11e-66PREDICTED: uncharacterized protein LOC107865897
RefseqXP_016567576.11e-66PREDICTED: uncharacterized protein LOC107865897
SwissprotQ9CA512e-34MIF1_ARATH; Mini zinc finger protein 1
TrEMBLM1BQ296e-47M1BQ29_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000502862e-46(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.14e-21mini zinc finger 1